Gen-script
All about genes

ASXL1: additional sex combs like 1, transcriptional regulator

BOPS, MDS

Summary

This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Organism: human (Homo sapiens)

ASXL1 description

asxl1 crispr knockout and activation products (m)

Catalog: sc-432808 | Size: Ask | Price: Ask Supplier: Santa Cruz Biotechnology

ASK
 ASXL1 CRISPR Knockout and Activation Products (m)  ASXL1 CRISPR Knockout and Activation Products (m)  ASXL1 CRISPR Knockout and Activation Products (m)  ASXL1 CRISPR Knockout and Activation Products (m)

mouse ASXL1-specific CRISPR/Cas9 KO Plasmid, HDR Plasmid, Double Nickase Plasmids, CRISPR Activation Plasmids and Lentiviral Activation Particles

asxl1 sirna (h), shrna and lentiviral particle gene silencers

Catalog: sc-72572 | Size: Ask | Price: Ask Supplier: Santa Cruz Biotechnology

ASK
 ASXL1 siRNA (h), shRNA and Lentiviral Particle Gene Silencers  ASXL1 siRNA (h), shRNA and Lentiviral Particle Gene Silencers  ASXL1 siRNA (h), shRNA and Lentiviral Particle Gene Silencers

human ASXL1-specific siRNA, shRNA Plasmid and Lentiviral Particle gene silencers

asxl1 sirna (m), shrna and lentiviral particle gene silencers

Catalog: sc-141310 | Size: Ask | Price: Ask Supplier: Santa Cruz Biotechnology

ASK
 ASXL1 siRNA (m), shRNA and Lentiviral Particle Gene Silencers  ASXL1 siRNA (m), shRNA and Lentiviral Particle Gene Silencers  ASXL1 siRNA (m), shRNA and Lentiviral Particle Gene Silencers

mouse ASXL1-specific siRNA, shRNA Plasmid and Lentiviral Particle gene silencers

asxl1 antibody (6e2)

Catalog: sc-293204 | Size: Ask | Price: Ask Supplier: Santa Cruz Biotechnology

ASK
 ASXL1 Antibody (6E2)  ASXL1 Antibody (6E2)

recommended for detection of ASXL1 of mouse, rat and human origin by WB, IP and ELISA

asxl1 crispr knockout and activation products (h)

Catalog: sc-401252 | Size: Ask | Price: Ask Supplier: Santa Cruz Biotechnology

ASK
 ASXL1 CRISPR Knockout and Activation Products (h)  ASXL1 CRISPR Knockout and Activation Products (h)  ASXL1 CRISPR Knockout and Activation Products (h)  ASXL1 CRISPR Knockout and Activation Products (h)

human ASXL1-specific CRISPR/Cas9 KO Plasmid, HDR Plasmid, Double Nickase Plasmids, CRISPR Activation Plasmids and Lentiviral Activation Particles

Asxl1 lentiviral vector (human) (cmv) (plenti-giii-cmv) Catalog: LV082288 | Size: 1.0 µg DNA | Price: €3332.66 Supplier: ABM lentivectors

ASK
DNA lentivector for transduction information Lentiveral packaging plasmid DNA for non-viral plasmid transfection and direct use in plasmid expression. This DNA can alos be used for packaging into Lentiviral particles for high efficiency transduction and stably integrated expressions. GENTAUR suggests to use our ABM packaging mix LV003 of second generation virusses or the LV053, our 3rd Generation Packaging mixture. pLenti lentiviral plasmids DNAs are stored in 10milliMolar Tris/HCI with 1mM EDTA at a pH of 8 at -25 C. Vectors with selection markers like kanamycin, puromycin or cumate are available. Lentiviral technical files <a href="https://www.abmgood.com/UbC-Lentivirus-System.html" target="_blank" title="https://www.abmgood.com/UbC-Lentivirus-System.html"><i class="fa fa-external-link" aria-hidden="true"></i></a> Lentivirus references <a href="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf" target="_blank" title="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf"><i class="fa fa-external-link" aria-hidden="true"></i></a>
Asxl1 lentiviral vector (human) (cmv) (plenti-giii-cmv-c-term-ha) Catalog: LV082289 | Size: 1.0 µg DNA | Price: €3332.66 Supplier: ABM lentivectors

ASK
DNA lentivector for transduction information Lentiveral packaging plasmid DNA for non-viral plasmid transfection and direct use in plasmid expression. This DNA can alos be used for packaging into Lentiviral particles for high efficiency transduction and stably integrated expressions. GENTAUR suggests to use our ABM packaging mix LV003 of second generation virusses or the LV053, our 3rd Generation Packaging mixture. pLenti lentiviral plasmids DNAs are stored in 10milliMolar Tris/HCI with 1mM EDTA at a pH of 8 at -25 C. Vectors with selection markers like kanamycin, puromycin or cumate are available. Lentiviral technical files <a href="https://www.abmgood.com/UbC-Lentivirus-System.html" target="_blank" title="https://www.abmgood.com/UbC-Lentivirus-System.html"><i class="fa fa-external-link" aria-hidden="true"></i></a> Lentivirus references <a href="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf" target="_blank" title="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf"><i class="fa fa-external-link" aria-hidden="true"></i></a>
Asxl1 lentiviral vector (human) (cmv) (plenti-giii-cmv-gfp-2a-puro) Catalog: LV082290 | Size: 1.0 µg DNA | Price: €3332.66 Supplier: ABM lentivectors

ASK
DNA lentivector for transduction information Lentiveral packaging plasmid DNA for non-viral plasmid transfection and direct use in plasmid expression. This DNA can alos be used for packaging into Lentiviral particles for high efficiency transduction and stably integrated expressions. GENTAUR suggests to use our ABM packaging mix LV003 of second generation virusses or the LV053, our 3rd Generation Packaging mixture. pLenti lentiviral plasmids DNAs are stored in 10milliMolar Tris/HCI with 1mM EDTA at a pH of 8 at -25 C. Vectors with selection markers like kanamycin, puromycin or cumate are available. Lentiviral technical files <a href="https://www.abmgood.com/UbC-Lentivirus-System.html" target="_blank" title="https://www.abmgood.com/UbC-Lentivirus-System.html"><i class="fa fa-external-link" aria-hidden="true"></i></a> Lentivirus references <a href="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf" target="_blank" title="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf"><i class="fa fa-external-link" aria-hidden="true"></i></a>
Asxl1 lentiviral vector (human) (cmv) (plenti-giii-cmv-rfp-2a-puro) Catalog: LV082291 | Size: 1.0 µg DNA | Price: €3332.66 Supplier: ABM lentivectors

ASK
DNA lentivector for transduction information Lentiveral packaging plasmid DNA for non-viral plasmid transfection and direct use in plasmid expression. This DNA can alos be used for packaging into Lentiviral particles for high efficiency transduction and stably integrated expressions. GENTAUR suggests to use our ABM packaging mix LV003 of second generation virusses or the LV053, our 3rd Generation Packaging mixture. pLenti lentiviral plasmids DNAs are stored in 10milliMolar Tris/HCI with 1mM EDTA at a pH of 8 at -25 C. Vectors with selection markers like kanamycin, puromycin or cumate are available. Lentiviral technical files <a href="https://www.abmgood.com/UbC-Lentivirus-System.html" target="_blank" title="https://www.abmgood.com/UbC-Lentivirus-System.html"><i class="fa fa-external-link" aria-hidden="true"></i></a> Lentivirus references <a href="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf" target="_blank" title="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf"><i class="fa fa-external-link" aria-hidden="true"></i></a>
Asxl1 lentiviral vector (human) (ubc) (plenti-giii-ubc) Catalog: LV082292 | Size: 1.0 µg DNA | Price: €3332.66 Supplier: ABM lentivectors

ASK
DNA lentivector for transduction information Lentiveral packaging plasmid DNA for non-viral plasmid transfection and direct use in plasmid expression. This DNA can alos be used for packaging into Lentiviral particles for high efficiency transduction and stably integrated expressions. GENTAUR suggests to use our ABM packaging mix LV003 of second generation virusses or the LV053, our 3rd Generation Packaging mixture. pLenti lentiviral plasmids DNAs are stored in 10milliMolar Tris/HCI with 1mM EDTA at a pH of 8 at -25 C. Vectors with selection markers like kanamycin, puromycin or cumate are available. Lentiviral technical files <a href="https://www.abmgood.com/UbC-Lentivirus-System.html" target="_blank" title="https://www.abmgood.com/UbC-Lentivirus-System.html"><i class="fa fa-external-link" aria-hidden="true"></i></a> Lentivirus references <a href="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf" target="_blank" title="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf"><i class="fa fa-external-link" aria-hidden="true"></i></a>
Asxl1 lentiviral vector (human) (ef1a) (plenti-giii-ef1a) Catalog: LV082293 | Size: 1.0 µg DNA | Price: €3332.66 Supplier: ABM lentivectors

ASK
DNA lentivector for transduction information Lentiveral packaging plasmid DNA for non-viral plasmid transfection and direct use in plasmid expression. This DNA can alos be used for packaging into Lentiviral particles for high efficiency transduction and stably integrated expressions. GENTAUR suggests to use our ABM packaging mix LV003 of second generation virusses or the LV053, our 3rd Generation Packaging mixture. pLenti lentiviral plasmids DNAs are stored in 10milliMolar Tris/HCI with 1mM EDTA at a pH of 8 at -25 C. Vectors with selection markers like kanamycin, puromycin or cumate are available. Lentiviral technical files <a href="https://www.abmgood.com/UbC-Lentivirus-System.html" target="_blank" title="https://www.abmgood.com/UbC-Lentivirus-System.html"><i class="fa fa-external-link" aria-hidden="true"></i></a> Lentivirus references <a href="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf" target="_blank" title="http://compbio.dfci.harvard.edu/compbio/research/labprotocols/contentBlocks/0/contentBlock_files/file15/Lentivirus_Production_and_Transfection_Protocol.pdf"><i class="fa fa-external-link" aria-hidden="true"></i></a>
Human putative polycomb group protein asxl1 (asxl1) elisa kit Catalog: AE55294HU-96 | Size: 1x plate of 96 wells | Price: €735.31 Supplier: abebio

ASK
Description Human Putative Polycomb group protein ASXL1 (ASXL1) ELISA Kit is manufactured by highest quality antibodies and plates to provide you with excellent and reproducible results in your work. The specifically designed buffers will ensure optimal conditions in each step from diluting the samples, through the incubation to washing. Storage and shipping Store and ship all of of the comptents of the EIA assay for Human Putative Polycomb group protein ASXL1 (ASXL1) on blue ice/ice packs at +4 degrees Celcius. Afoid freezing and especially freeze-thaw cycles as such cycles may denaturate the peptide chains in the antibodies, standards and enzymes, thus reducing the activity and sensitivity of the kit. Advise tips Small volumes of the liquid components of the ASXL1 ELISA Kit may get caught on the vials' walls and seals. Prior to use, briefly centrifuge the vials to ensure that all of the vial's content is on the bottom of the vial.
Elisa test for human putative polycomb group protein asxl1 (asxl1) Catalog: AE55294HU-48 | Size: 1x plate of 48 wells | Price: €447.86 Supplier: abebio

ASK
Description Human Putative Polycomb group protein ASXL1 (ASXL1) ELISA Kit is manufactured by highest quality antibodies and plates to provide you with excellent and reproducible results in your work. The specifically designed buffers will ensure optimal conditions in each step from diluting the samples, through the incubation to washing. Storage and shipping Store and ship all of of the comptents of the EIA assay for Human Putative Polycomb group protein ASXL1 (ASXL1) on blue ice/ice packs at +4 degrees Celcius. Afoid freezing and especially freeze-thaw cycles as such cycles may denaturate the peptide chains in the antibodies, standards and enzymes, thus reducing the activity and sensitivity of the kit. Advise tips Small volumes of the liquid components of the ASXL1 ELISA Kit may get caught on the vials' walls and seals. Prior to use, briefly centrifuge the vials to ensure that all of the vial's content is on the bottom of the vial.
Anti-asxl1 (center) antibody Catalog: AP50279PU-N | Size: 0,4 ml | Price: €704.81 Supplier: acr

ASK
Vial description KIAA0978 Category primary antibody Raised in Rabbit
Asxl1 antibody Catalog: 10R-1309 | Size: 50 µg | Price: €341 Supplier: fitzgerald

ASK
Category Primary Antibody Antibody Subtype Monoclonal Antibodies Area of research DNA & RNA
Asxl1 antibody - middle region Catalog: OAAB07377 | Size: one vial | Price: €509.1 Supplier: aviva

ASK
Recognized antigen ASXL1 - middle region Product type Antibody Gene name ASXL1
Recombinant human putative polycomb group protein asxl1 (n-gst) Catalog: CG54-1000 | Size: 1 mg | Price: €2984.94 Supplier: novo

ASK
Description Recombinant Human Additional sex combs-like protein 1 is produced by our E.coli expression system and the target gene encoding Lys1477-Arg1541 is expressed with a GST tag at the N-terminus. Species reactivity Human Origin Escherichia coli
Recombinant human putative polycomb group protein asxl1 (n-gst) Catalog: CG54-10 | Size: 10 ug | Price: €243.74 Supplier: novo

ASK
Description Recombinant Human Additional sex combs-like protein 1 is produced by our E.coli expression system and the target gene encoding Lys1477-Arg1541 is expressed with a GST tag at the N-terminus. Species reactivity Human Origin Escherichia coli
Recombinant human putative polycomb group protein asxl1 (n-gst) Catalog: CG54-50 | Size: 50 ug | Price: €596.75 Supplier: novo

ASK
Description Recombinant Human Additional sex combs-like protein 1 is produced by our E.coli expression system and the target gene encoding Lys1477-Arg1541 is expressed with a GST tag at the N-terminus. Species reactivity Human Origin Escherichia coli
Recombinant human putative polycomb group protein asxl1 (n-gst) Catalog: CG54-500 | Size: 500 ug | Price: €2108.43 Supplier: novo

ASK
Description Recombinant Human Additional sex combs-like protein 1 is produced by our E.coli expression system and the target gene encoding Lys1477-Arg1541 is expressed with a GST tag at the N-terminus. Species reactivity Human Origin Escherichia coli
Human asxl1 crispr knock out 293t cell line Catalog: K0138651 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type 293T NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out 293 cell line Catalog: K0138652 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type 293 NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out a549 cell line Catalog: K0138653 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type A549 NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out hela cell line Catalog: K0138654 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type HeLa NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out mda-mb-435 cell line Catalog: K0138655 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type MDA-MB-435 NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out hepg2 cell line Catalog: K0138656 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type HepG2 NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out mcf7 cell line Catalog: K0138657 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type MCF7 NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out k562 cell line Catalog: K0138658 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type K562 NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Human asxl1 crispr knock out u87-mg cell line Catalog: K0138659 | Size: 1x10^6 cells/1.0ml | Price: €6989.27 Supplier: ABM CrispR

ASK
Cell line type U87-MG NCBI number NM_015338 Availability Please contact us every day to check the availability and/or to request a quote. For larger or bulk quantities a discount may apply.
Asxl1 3'utr luciferase stable cell line Catalog: TU001304 | Size: 1 ml | Price: €1704.99 Supplier: ABM microrna

ASK
Availability Please contact us every day between 9am-6pm local time to check the availability and/or to request a quote. For larger quantities a discount may apply. Ordering If you wish to order this product, please include the catalogue number #TU001304 in your purchase order among with your shipping and billing information. Technical file Please contact us to request the latest datasheet, protocol, certificate of analysis and SDS files.
Asxl1 3'utr gfp stable cell line Catalog: TU051304 | Size: 1 ml | Price: €1704.99 Supplier: ABM microrna

ASK
Availability Please contact us every day between 9am-6pm local time to check the availability and/or to request a quote. For larger quantities a discount may apply. Ordering If you wish to order this product, please include the catalogue number #TU051304 in your purchase order among with your shipping and billing information. Technical file Please contact us to request the latest datasheet, protocol, certificate of analysis and SDS files.
Asxl1 3'utr lenti-reporter-luc virus Catalog: MV-h01304 | Size: 3 ml | Price: €911.33 Supplier: ABM microrna

ASK
Availability Please contact us every day between 9am-6pm local time to check the availability and/or to request a quote. For larger quantities a discount may apply. Ordering If you wish to order this product, please include the catalogue number #MV-h01304 in your purchase order among with your shipping and billing information. Technical file Please contact us to request the latest datasheet, protocol, certificate of analysis and SDS files.
Asxl1 3'utr lenti-reporter-gfp virus Catalog: MV-h51304 | Size: 3 ml | Price: €911.33 Supplier: ABM microrna

ASK
Availability Please contact us every day between 9am-6pm local time to check the availability and/or to request a quote. For larger quantities a discount may apply. Ordering If you wish to order this product, please include the catalogue number #MV-h51304 in your purchase order among with your shipping and billing information. Technical file Please contact us to request the latest datasheet, protocol, certificate of analysis and SDS files.
Asxl1 3'utr lenti-reporter-luc vector Catalog: MT-h01304 | Size: 1 ug | Price: €570.33 Supplier: ABM microrna

ASK
Availability Please contact us every day between 9am-6pm local time to check the availability and/or to request a quote. For larger quantities a discount may apply. Ordering If you wish to order this product, please include the catalogue number #MT-h01304 in your purchase order among with your shipping and billing information. Technical file Please contact us to request the latest datasheet, protocol, certificate of analysis and SDS files.
Asxl1 3'utr lenti-reporter-gfp vector Catalog: MT-h51304 | Size: 1 ug | Price: €570.33 Supplier: ABM microrna

ASK
Availability Please contact us every day between 9am-6pm local time to check the availability and/or to request a quote. For larger quantities a discount may apply. Ordering If you wish to order this product, please include the catalogue number #MT-h51304 in your purchase order among with your shipping and billing information. Technical file Please contact us to request the latest datasheet, protocol, certificate of analysis and SDS files.
Rabbit asxl1 polyclonal antibody Catalog: A9890 | Size: 50ul | Price: €278.56 Supplier: ABclonal

ASK
Description A recombinant protein of Human ASXL1 Target ASXL1 Clonality Polyclonal
Asxl1 adenovirus (human) Catalog: 071055A | Size: 250ul | Price: €1704.99 Supplier: abm Adinovirus

ASK
Product type Adenovirus Detection and sensitivity Before using ASXL1 Adenovirus (Human) please read the package insert. It is intended for Human reactivity. Accession Number: NM_015338 Performance and applications Please contact Gentaur's support by livechat, email or phone in order to receive the requested information. The product is for research use only.
Asxl1-ha adenovirus (human) Catalog: 071056A | Size: 250ul | Price: €1704.99 Supplier: abm Adinovirus

ASK
Product type Adenovirus Detection and sensitivity Before using ASXL1-HA Adenovirus (Human) please read the package insert. It is intended for Human reactivity. Accession Number: NM_015338 Performance and applications Please contact Gentaur's support by livechat, email or phone in order to receive the requested information. The product is for research use only.
Asxl1-his adenovirus (human) Catalog: 071057A | Size: 250ul | Price: €1704.99 Supplier: abm Adinovirus

ASK
Product type Adenovirus Detection and sensitivity Before using ASXL1-His Adenovirus (Human) please read the package insert. It is intended for Human reactivity. Accession Number: NM_015338 Performance and applications Please contact Gentaur's support by livechat, email or phone in order to receive the requested information. The product is for research use only.
Anti-asxl1 picoband antibody Catalog: A01099 | Size: 100µg/vial | Price: €468.27 Supplier: boster

ASK
Clonality Polyclonal Sample Size Available 30ug for $99, contact us for details Immunogen A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE).
Mouse monoclonal antibody anti-human asxl1[asxl1] Catalog: MBS120126 | Size: Ask | Price: Ask Supplier: MyBioSource

ASK
Products_type Antibody Products_gene_name [ASXL1] Reactivity Human
Human putative polycomb group protein asxl1 (asxl1) elisa kit[putative polycomb group protein asxl1] Catalog: MBS282379 | Size: Ask | Price: Ask Supplier: MyBioSource

ASK
Products_type ELISA Kit Products_gene_name [ASXL1] Reactivity Human
Anti-asxl1 (putative polycomb group protein asxl1) antibody[asxl1] Catalog: MBS418061 | Size: Ask | Price: Ask Supplier: MyBioSource

ASK
Products_type Antibody Products_gene_name [ASXL1] Reactivity Human, Mouse
Asxl1 (kiaa0978, putative polycomb group protein asxl1, additional sex combs-like protein 1, mgc117280, mgc71111)[asxl1] Catalog: MBS641787 | Size: Ask | Price: Ask Supplier: MyBioSource

ASK
Products_type Antibody Reactivity Human Form Supplied as a liquid in PBS, pH 7.2.
Recombinant mouse putative polycomb group protein asxl1 (asxl1), partial[putative polycomb group protein asxl1 (asxl1), partial] Catalog: MBS968488 | Size: Ask | Price: Ask Supplier: MyBioSource

ASK
Products_type Recombinant Protein Products_gene_name [Asxl1] Form Liquid containing glycerol
Asxl1 antibody Catalog: abx135834 | Size: 200 µl | Price: €755.24 Supplier: abbex

ASK
Category Primary Antibodies Clonality Polyclonal Raised in Rabbit
uid :
171023

name :
ASXL1

description :
additional sex combs like 1, transcriptional regulator

chromosome :
20

geneticsource :
genomic

maplocation :
20q11.21

otheraliases :
BOPS, MDS

otherdesignations :
putative Polycomb group protein ASXL1|additional sex combs like transcriptional regulator 1

nomenclaturesymbol :
ASXL1

nomenclaturename :
additional sex combs like 1, transcriptional regulator

nomenclaturestatus :
Official

geneweight :
12462

chrsort :
20

chrstart :
32358061

annotationrelease: 109
assemblyaccver: GCF_000001405.38
chraccver: NC_000020.11
chrstart: 32358061
chrstop: 32439318
annotationrelease: 108
assemblyaccver: GCF_000001405.33
chraccver: NC_000020.11
chrstart: 32358061
chrstop: 32439318
annotationrelease: 108
assemblyaccver: GCF_000306695.2
chraccver: NC_018931.2
chrstart: 30850604
chrstop: 30932051
annotationrelease: 107
assemblyaccver: GCF_000001405.28
chraccver: NC_000020.11
chrstart: 32358343
chrstop: 32439318
annotationrelease: 107
assemblyaccver: GCF_000306695.2
chraccver: NC_018931.2
chrstart: 30850604
chrstop: 30932051
annotationrelease: 106
assemblyaccver: GCF_000001405.26
chraccver: NC_000020.11
chrstart: 32358333
chrstop: 32439318
annotationrelease: 106
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27742559
chrstop: 27816602
annotationrelease: 106
assemblyaccver: GCF_000306695.2
chraccver: NC_018931.2
chrstart: 30850604
chrstop: 30932051
annotationrelease: 105
assemblyaccver: GCF_000001405.25
chraccver: NC_000020.10
chrstart: 30946146
chrstop: 31027121
annotationrelease: 105
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27742559
chrstop: 27816602
annotationrelease: 105
assemblyaccver: GCF_000306695.2
chraccver: NC_018931.2
chrstart: 30850604
chrstop: 30932051
annotationrelease: 104
assemblyaccver: GCF_000001405.22
chraccver: NC_000020.10
chrstart: 30946146
chrstop: 31027121
annotationrelease: 104
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27742559
chrstop: 27816602
annotationrelease: 104
assemblyaccver: GCF_000306695.1
chraccver: NC_018931.1
chrstart: 30960118
chrstop: 31041161
annotationrelease: 103
assemblyaccver: GCF_000001405.21
chraccver: NC_000020.10
chrstart: 30946146
chrstop: 31027121
annotationrelease: 103
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27742559
chrstop: 27816602
annotationrelease: 37.3
assemblyaccver: GCF_000001405.17
chraccver: NC_000020.10
chrstart: 30946146
chrstop: 31027121
annotationrelease: 37.3
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27742559
chrstop: 27816602
annotationrelease: 37.2
assemblyaccver: GCF_000001405.14
chraccver: NC_000020.10
chrstart: 30946146
chrstop: 31027121
annotationrelease: 37.2
assemblyaccver: GCF_000002115.2
chraccver: AC_000063.1
chrstart: 27702182
chrstop: 27783145
annotationrelease: 37.2
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27742559
chrstop: 27816602
annotationrelease: 37.1
assemblyaccver: GCF_000001405.13
chraccver: NC_000020.10
chrstart: 30946152
chrstop: 31027121
annotationrelease: 37.1
assemblyaccver: GCF_000002115.2
chraccver: AC_000063.1
chrstart: 27702188
chrstop: 27783145
annotationrelease: 37.1
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27742559
chrstop: 27816602
annotationrelease: 36.3
assemblyaccver: GCF_000001405.12
chraccver: NC_000020.9
chrstart: 30409813
chrstop: 30490782
annotationrelease: 36.3
assemblyaccver: GCF_000002115.2
chraccver: AC_000063.1
chrstart: 27702188
chrstop: 27783145
annotationrelease: 36.3
assemblyaccver: GCF_000002125.1
chraccver: AC_000152.1
chrstart: 27735243
chrstop: 27816602